PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG002100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 27025.7 Da    PI: 8.9194
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG002100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.81.4e-283483251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         rie+++ rqvtfskRr+g+lKKA+ELSvLC+aeva+i+fs++g+ly ++s
  Pavir.1NG002100.2.p 34 RIEDSTSRQVTFSKRRKGLLKKAHELSVLCEAEVALIVFSPRGRLYQFAS 83
                         8***********************************************86 PP

2K-box68.12.9e-23103183585
                K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                          ++++++e   e+++ e++ L ++i+ ++ ++R+llGe+L+s+s+keLq+Le qLe+sl++iR++K++ l ++   l+ + k
  Pavir.1NG002100.2.p 103 TNERVDEPGVEKWKYEATTLGQKIDAIEASKRKLLGESLGSCSIKELQELELQLENSLSSIRQRKEQKLAKENAMLRDQCK 183
                          4556889999************************************************************99988887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.2682585IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-352584IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002781IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-282747IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.55E-3027116IPR002100Transcription factor, MADS-box
PfamPF003192.8E-263481IPR002100Transcription factor, MADS-box
CDDcd002656.48E-3435100No hitNo description
PRINTSPR004049.2E-284762IPR002100Transcription factor, MADS-box
PRINTSPR004049.2E-286283IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.902112196IPR002487Transcription factor, K-box
PfamPF014869.8E-22112184IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MAATAAAPDQ RQIVPSDASR MRKQGRRGRR EMRRIEDSTS RQVTFSKRRK GLLKKAHELS  60
VLCEAEVALI VFSPRGRLYQ FASATDLQNT IDRYLNHTKG TPTNERVDEP GVEKWKYEAT  120
TLGQKIDAIE ASKRKLLGES LGSCSIKELQ ELELQLENSL SSIRQRKEQK LAKENAMLRD  180
QCKALPLLEL NDKGHMEAAT AAAGEEKEAD DGRMEDVETE LAIGIGRGRS IMDRLTSKPD  240
C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J2e-1727113285Myocyte-specific enhancer factor 2A
3p57_I2e-1727113285Myocyte-specific enhancer factor 2A
3p57_D2e-1727113285Myocyte-specific enhancer factor 2A
3p57_C2e-1727113285Myocyte-specific enhancer factor 2A
3p57_B2e-1727113285Myocyte-specific enhancer factor 2A
3p57_A2e-1727113285Myocyte-specific enhancer factor 2A
3kov_J2e-1727113285Myocyte-specific enhancer factor 2A
3kov_I2e-1727113285Myocyte-specific enhancer factor 2A
3kov_B2e-1727113285Myocyte-specific enhancer factor 2A
3kov_A2e-1727113285Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.207901e-115stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701695.11e-105PREDICTED: MADS-box protein SOC1-like isoform X2
SwissprotO646451e-58SOC1_ARATH; MADS-box protein SOC1
TrEMBLK3Z0C21e-102K3Z0C2_SETIT; Uncharacterized protein
STRINGSi019985m1e-101(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-49AGAMOUS-like 20